PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00100685001
Common NameGSBRNA2T00100685001, LOC106412103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 337aa    MW: 36452.1 Da    PI: 9.7873
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00100685001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.61e-3678136361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          e a+kcprCds ntkfCyynny+l+qPryfCk+CrryWt+GGa rnvPvGgg+r+n k+
  GSBRNA2T00100685001  78 EGARKCPRCDSLNTKFCYYNNYNLTQPRYFCKGCRRYWTHGGAQRNVPVGGGSRRNSKK 136
                          56789**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2563126IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3080135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.49181135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVFSSDWSQP TNSNHQQHQL HENGSLVSGH GLLSHQLQPY PPNPNPNYHH AAASSGLPAR  60
LGGSMAERAR QAKAPPPEGA RKCPRCDSLN TKFCYYNNYN LTQPRYFCKG CRRYWTHGGA  120
QRNVPVGGGS RRNSKKGKNG NSKSSSSSSK QSSSTVNAPS SNSGQLKTNH QFPFLPTLHN  180
LTQLGGIGLN LAATNGNYCQ AHQIGPSLMN DLGFLHVGNG RTGNIHDNNN NSGENNLMAA  240
AGSMNQFTLF DPATGLHAFQ NESNIGNNFG ISFSSTSMVD SRAYQTTPVK MEEQPSLVNL  300
SRPVSSLTPP GNQTNQYFWT NSDLSGPFSK DHHQLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.299110.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00100685001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013708448.10.0PREDICTED: dof zinc finger protein DOF1.1-like isoform X1
SwissprotQ8L9V61e-154DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A078E3L10.0A0A078E3L1_BRANA; BnaC05g05320D protein
STRINGBra030696.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.31e-134Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]